PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G029400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 282aa    MW: 30385.4 Da    PI: 4.3926
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G029400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM24.38.6e-081762348
                 NAM  3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                        p f+F+Ptde+lv +yL +++ g +++ ++++ + d   v Pw+  
  Brast05G029400.1.p 17 PAFKFDPTDEDLVIHYLLPRALGLPCPHSHAVIDGDPGGVPPWEVL 62
                        78***********************9998999999********974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-1410127IPR003441NAC domain
PfamPF023654.3E-817116IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
FPWAAAAHGF SPPGGSPAFK FDPTDEDLVI HYLLPRALGL PCPHSHAVID GDPGGVPPWE  60
VLERHGIDMP SSSARPAVFL RPGDGAELEV AFNRYNLTFY DGRSERSTGF VMHEFEVTEP  120
PLAGAKLTRV RFDKARERMA EKLARETAAA DGGGEDDQVY CVDPLEVVFP GPGEFSGGGY  180
TQDVLDNFYE KMEYEQFLLF QQYEMEQQQY YGQTGDPSNG GEGCSGGGGQ DGGSDHGSDG  240
GTGSTVSHCG DGADADDGKG FYHARPKDLF VCSRRKITLV F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239269.11e-114PREDICTED: NAC transcription factor NAM-B1-like
TrEMBLI1IN141e-114I1IN14_BRADI; Uncharacterized protein
STRINGBRADI4G24060.11e-113(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1861527